Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011069-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011069-M01, RRID:AB_464280
- Product name
- RAPGEF4 monoclonal antibody (M01), clone 1C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAPGEF4.
- Antigen sequence
MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIF
TRLKEVKAFEKFHPNLLHQICLCGYYENLEKGITL
FRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTIC
TLGIG- Isotype
- IgG
- Antibody clone number
- 1C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RAPGEF4 expression in transfected 293T cell line by RAPGEF4 monoclonal antibody (M01), clone 1C11.Lane 1: RAPGEF4 transfected lysate (Predicted MW: 115.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RAPGEF4 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol