HPA029773

ERCC1 antibody from MilliporeSigma / Merck KGaA
RAD10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029773
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029773, RRID:AB_10602129
Product name
Anti-ERCC1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029773
Antibody type
Polyclonal
Antigen
excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LADCTLILAWSPEEAGRYLETYKAYEQKPADLLME
KLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSL
EQLIAASREDLALCPGLGPQKARRLFDVLHEPFLK
VP
Storage
-20C
Provider Type Product Number
- No reagents -