HPA026678

CLIP1 antibody from Sigma-Aldrich
CLIP, CLIP-170, CLIP170, CYLN1, RSN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026678
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026678, RRID:AB_1846954
Product name
Anti-CLIP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026678
Antibody type
Polyclonal
Antigen
CAP-Gly domain-containing linker protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KNLELQLKENKRQLSSSSGNTDTQADEDERAQESQ
IDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGD
DLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTED
CPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGH
WATNCNDDET
Storage
-20C
Provider Type Product Number
- No reagents -