HPA000161

GPRASP1 antibody from Sigma-Aldrich
GASP, GASP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000161
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000161, RRID:AB_2247872
Product name
Anti-GPRASP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000161
Antibody type
Polyclonal
Antigen
G-protein coupled receptor-associated sorting protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VEACVEGDVNSKSSLEDKEEAMIPCFGAKEEVSMK
HGTGVRCRFMAGAEETNNKSCFWAEKEPCMYPAGG
GSWKSRPEEEEDIVNSWFWSRKYTKPEAIIGSWLW
ATEESNIDGTGEKAKLLTEE
Storage
-20C
Provider Type Product Number
- No reagents -