H00002571-M01A

GAD1 antibody from Abnova Corporation
GAD
No application information provided.

Antibody data

Product number
H00002571-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002571-M01A, RRID:AB_1019102
Product name
GAD1 monoclonal antibody (M01A), clone 1D12
Provider product page
Abnova Corporation - H00002571-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant GAD1.
Antigen sequence
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGV
AHGCTRKLGLKICGFLQRTNSLEEKSRLVSAFKER
QSSKNLLSCENSDRDARFRRTETDFSNLFARDLLP
AKNGEEQTVQFLLEVVDILLNYVRKTFDRSTKVLD
FHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDT
LKYGVRTGHPRFFNQLSTGLDIIGLAGEWLTSTAN
TNMFTYEIAPVFVLMEQITLKKMREIVGWSSKDGD
GIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVP
KLVLFTSEQSHYSIKKAGAALGFGTDNVILIKCNE
RGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVY
GAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRK
HRHKLNGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQC
GRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYL
YAKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRGV
PDSPQRREKLHKVAPKIKALMMESGTTMVGYQPQG
DKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
Isotype
IgM
Antibody clone number
1D12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -