H00009759-B01

HDAC4 antibody from Abnova Corporation
BDMR, HA6116, HD4, HDAC-4, HDAC-A, HDACA, KIAA0288

Antibody data

Product number
H00009759-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009759-B01, RRID:AB_1204449
Product name
HDAC4 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00009759-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human HDAC4 protein.
Antigen sequence
MLAMKHQQELLEHQRKLERHRQEQELEKQHREQKL
QQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALA
HRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVS
TSYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLK
QKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSAC
SSAPGSGPSSPNNSSGSVSAENGIAPAVPSIPAET
SLAHRLVAREGSAAPLPLYTSPSLPNITLGLPATG
PSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYL
STSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTD
WYLSGLGALPLHAQSLVGADRVSPSIHKLRQHRPL
GRTQSAPLPQNAQALQHLVIQQQHQQFLEKHKQQF
QQQQLQMNKIIPKPSEPARQPESHPEETEEELREH
QALLDEPYLDRLPGQKEAHAQAGVQVKQEPIESDE
EEAEPPREVEPGQRQPSEQELLFRQQALLLEQQRI
HQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASA
TFPVSVQEPPTKPRFTTGLVYDTLMLKHQCTCGSS
SSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKAT
LEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSL
ASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGC
VVELVFKVATGELKNGFAVVRPPGHHAEESTPMGF
CYFNSVAVAAKLLQQRLSVSKILIVDWDVHHGNGT
QQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGT
GPGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMP
IASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARC
FGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEA
CVSALLGNELDPLPEKVLQQRPNANAVRSMEKVME
IHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVT
AMASLSVGVKPAEKRPDEEPMEEEPPL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -