H00000871-B01P

SERPINH1 antibody from Abnova Corporation
CBP1, CBP2, colligen, HSP47, SERPINH2

Antibody data

Product number
H00000871-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000871-B01P, RRID:AB_1580508
Product name
SERPINH1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00000871-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SERPINH1 protein.
Antigen sequence
MRSLLLLSAFCLLEAALAAEVKKPAAAAAPGTAEK
LSPKAATLAERSAGLAFSLYQAMAKDQAVENILVS
PVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDE
EVHAGLGELLRSLSNSTARNVTWKLGSRLYGPSSV
SFADDFVRSSKQHYNCEHSKINFRDKRSALQSINE
WAAQTTDGKLPEVTKDVERTDGALLVNAMFFKPHW
DEKFHHKMVDNRGFMVTRSYTVGVMMMHRTGLYNY
YDDEKEKLQIVEMPLAHKLSSLIILMPHHVEPLER
LEKLLTKEQLKIWMGKMQKKAVAISLPKGVVEVTH
DLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLAS
VFHATAFELDTDGNPFDQDIYGREELRSPKLFYAD
HPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -