Antibody data

Product number
NSJ Bioreagents
Product name
HuD Antibody / ELAVL4
Provider product page
NSJ Bioreagents - R32036
Antibody type
Amino acids MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK of human ELAVL4/HuD were used as the immunogen for the HuD antibody.
Antigen affinity
Human, Mouse, Rat
Vial size
100 µg
Lyophilized; resuspend with 200 ul for 0.5 mg/ml
After reconstitution, the HuD antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -