Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001996-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001996-M01, RRID:AB_530032
- Product name
- ELAVL4 monoclonal antibody (M01), clone 6B9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ELAVL4.
- Antigen sequence
VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMT
NYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS- Isotype
- IgG
- Antibody clone number
- 6B9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ELAVL4 expression in transfected 293T cell line by ELAVL4 monoclonal antibody (M01), clone 6B9.Lane 1: ELAVL4 transfected lysate(40.4 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ELAVL4 monoclonal antibody (M01), clone 6B9. Western Blot analysis of ELAVL4 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ELAVL4 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to ELAVL4 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1.2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
