Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502051 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like 4 (Hu Antigen D) (ELAVL4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ELAVL4 antibody: synthetic peptide directed towards the N terminal of human ELAVL4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSI
GEIES CKLVRDKITG- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Post-transcriptional regulation of neuro-oncological ventral antigen 1 by the neuronal RNA-binding proteins ELAV.
Ratti A, Fallini C, Colombrita C, Pascale A, Laforenza U, Quattrone A, Silani V
The Journal of biological chemistry 2008 Mar 21;283(12):7531-41
The Journal of biological chemistry 2008 Mar 21;283(12):7531-41
No comments: Submit comment
No validations: Submit validation data