HPA000996

ARMCX5 antibody from Sigma-Aldrich
FLJ12969, GASP5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000996
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000996, RRID:AB_1078212
Product name
Anti-ARMCX5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000996
Antibody type
Polyclonal
Antigen
Armadillo repeat-containing X-linked protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QAKAGDGAMTRTHTVTYREAMAVTREVIKVEDTTK
TRVMVETKTKPLAERSIVPQTKSKAMPMSRVSTVT
KSEVKVVAVIEANIRSYAKSHDKANTGSRPDRREE
TSIGMKSSDEDEE
Storage
-20C
Provider Type Product Number
- No reagents -