HPA046972

IGFBP1 antibody from Atlas Antibodies
AFBP, hIGFBP-1, IBP1, IGF-BP25, PP12
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA046972
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA046972, RRID:AB_2679884
Product name
Anti-IGFBP1
Provider product page
Atlas Antibodies - HPA046972
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QQPLHALTRGQGACVQESDASAPHAAEAGSPESPE
STEITEEELLDNFHLMAPSEEDHSILWDAISTYDG
S
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -