HPA050124

antibody from Atlas Antibodies

Targeting: IL4R CD124

Antibody data

Submit

Validation data

Product number: HPA050124 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA050124, RRID:AB_2681026
Product name: Anti-IL4R
Antibody type: Polyclonal
Description: Affinity purified using the PrEST antigen as affinity ligand
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSE AHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWA GQQLLWKGSFKPSEHVKPRAPGNLTVHTNVS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

IL4R protein structure - HPA050124 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human tonsil and cerebral cortex tissues using HPA050124 antibody. Corresponding IL4R RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in astrocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows no cytoplasmic positivity in glandular cells as expected.
Sample type: HUMAN