Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN634483 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interleukin 15 (IL15) antibody
- Antibody type
- Polyclonal
- Antigen
- IL15 antibody was raised using the N terminal of IL15 corresponding to a region with amino acids RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV
- Description
- Affinity purified
- Reactivity
- Human
- Host
- Rabbit
- Vial size
- 50 μg
- Concentration
- 1 mg/ml
- Storage
- 4°C
No comments: Submit comment
No validations: Submit validation data