Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003654-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003654-M01, RRID:AB_530093
- Product name
- IRAK1 monoclonal antibody (M01), clone 3F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IRAK1.
- Antigen sequence
SSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPN
QPVESDESLGGLSAALRSWHLTPSCPLDPAPLREA
GCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASS
SSEPPQIIINPARQKMVQKLALYEDGALDSLQLLS
SSSLPGLGLEQDRQGPEESDEFQS- Isotype
- IgG
- Antibody clone number
- 3F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of IRAK1 expression in transfected 293T cell line by IRAK1 monoclonal antibody (M01), clone 3F7.Lane 1: IRAK1 transfected lysate(68 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged IRAK1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to IRAK1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of IRAK1 transfected lysate using anti-IRAK1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with IRAK1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to IRAK1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol