Antibody data

Product number
H00003726-B03P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003726-B03P, RRID:AB_1576508
Product name
JUNB purified MaxPab mouse polyclonal antibody (B03P)
Provider product page
Abnova Corporation - H00003726-B03P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human JUNB protein.
Antigen sequence
MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLL
KPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFS
GQGSDTGASLKLASSELERLIVPNSNGVITTTPTP
PGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFV
KALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAG
PEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPT
TTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQT
VPEARSRDATPPVSPINMEDQERIKVERKRLRNRL
AATKCRKRKLERIARLEDKVKTLKAENAGLSSTAG
LLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -