H00005589-B01

PRKCSH antibody from Abnova Corporation
G19P1, GIIB, PCLD, PLD1, VASAP-60

Antibody data

Product number
H00005589-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005589-B01, RRID:AB_1579150
Product name
PRKCSH MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00005589-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PRKCSH protein.
Antigen sequence
MAEVTREGFRLKKILIEDWKKAREEKQKKLIELQA
GKKSLEDQVEMLRTVKEEAEKPEREAKEQHQKLWE
EQLAAAKAQQEQELAADAFKELDDDMDGTVSVTEL
QTHPELDTDGDGALSEAEAQALLSGDTQTDATSFY
DRVWAAIRDKYRSEALPTDLPTPSAPDLTEPKEEQ
PPVPSSPTEEEEEEEEEEEEAEEEEEEEDSEEAPP
PLSPPQPASPAEEDKMPPYDEQTQAFIDAAQEARN
KFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAY
LYSQCYELTTNEYVYRLCPFKLVSQKPKLGGSPTS
LGTWGSWIGPDHDKFSAMKYEQGTGCWQGPNRSTT
VRLLCGKETMVTSTTEPSRCEYLMELMTPAACPEP
PPEAPTEDDHDEL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -