HPA001008

IL13RA1 antibody from Sigma-Aldrich
CD213a1, IL-13Ra, NR4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001008
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001008, RRID:AB_1851631
Product name
Anti-IL13RA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001008
Antibody type
Polyclonal
Antigen
Interleukin-13 receptor alpha-1 chain Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSL
WYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVG
SQCSTNESEKPSILVEKCISPPEGDPESAVTELQC
IWHNLSYMKCSWLPGRNT
Storage
-20C
Provider Type Product Number
- No reagents -