Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503845 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Platelet-Activating Factor Acetylhydrolase 1b, Regulatory Subunit 1 (45kDa) (PAFAH1B1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PAFAH1B1 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEA
ELDVN EELDKKYAGL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Platelet activating factor-acetylhydrolase (PAF-AH) activity and HDL levels, but not PAF-AH gene polymorphisms, are associated with successful aging in Sicilian octogenarians.
Campo S, Sardo MA, Trimarchi G, Bonaiuto A, Saitta C, Bitto A, Castaldo M, Cinquegrani M, Bonaiuto M, Cristadoro S, Saitta A
Aging clinical and experimental research 2008 Apr;20(2):171-7
Aging clinical and experimental research 2008 Apr;20(2):171-7
No comments: Submit comment
No validations: Submit validation data