HPA020036

PAFAH1B1 antibody from Sigma-Aldrich
LIS1, MDCR, MDS, PAFAH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020036
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020036, RRID:AB_1854925
Product name
Anti-PAFAH1B1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020036
Antibody type
Polyclonal
Antigen
Platelet-activating factor acetylhydrolase IB subunit alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGL
LEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPL
GQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVF
SVMVSASEDATIKVWDYETGDFERTLKGHTDSVQD
ISFDHS
Storage
-20C
Provider Type Product Number
- No reagents -