ABIN501556

HELLS antibody from antibodies-online
LSH, Nbla10143, PASG, SMARCA6

Antibody data

Product number
ABIN501556
Provider
antibodies-online
Product name
anti-Helicase, Lymphoid-Specific (HELLS) (Middle Region) antibody
Provider product page
antibodies-online - ABIN501556
Antibody type
Polyclonal
Antigen
The immunogen for anti-HELLS antibody: synthetic peptide directed towards the middle region of human HELLS
Description
Affinity Purified
Reactivity
Human, Mouse, Bovine, Canine, Xenopus
Host
Rabbit
Antigen sequence
QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREK
VISDK DLELLLDRSD
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -