Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502166 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the N terminal of human ABCB4
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Rabbit
- Host
- Rabbit
- Antigen sequence
AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENA
KEIGI KKAISANISM- Vial size
- 50 µg
Submitted references Hepatobiliary phospholipid transporter ABCB4, MDR3 gene variants in a large cohort of Italian women with intrahepatic cholestasis of pregnancy.
Floreani A, Carderi I, Paternoster D, Soardo G, Azzaroli F, Esposito W, Montagnani M, Marchesoni D, Variola A, Rosa Rizzotto E, Braghin C, Mazzella G
Digestive and liver disease : official journal of the Italian Society of Gastroenterology and the Italian Association for the Study of the Liver 2008 May;40(5):366-70
Digestive and liver disease : official journal of the Italian Society of Gastroenterology and the Italian Association for the Study of the Liver 2008 May;40(5):366-70
No comments: Submit comment
No validations: Submit validation data