H00004205-M31

MEF2A antibody from Abnova Corporation
RSRFC4, RSRFC9
No application information provided.

Antibody data

Product number
H00004205-M31
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004205-M31, RRID:AB_1237779
Product name
MEF2A monoclonal antibody (M31), clone 1D2
Provider product page
Abnova Corporation - H00004205-M31
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MEF2A.
Antigen sequence
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYEL
SVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYT
EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSY
VLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNF
SMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLT
DSSMLSPPQTTLHRNVSPGAPQRPPSTGNAGGMLS
TTDLTVPNGAGSSPVGNGFVNSRASPNLIGATGAN
SLGKVMPTKSPPPPGGGNLGMNSRRPDLRVVIPPS
SKGMMPPLNTQRISSSQATQPLATPVVSVTTPSLP
PQGLVYSAMPTAYNTDYSLTSADLSALQGFNSPGM
LSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLS
INTNQNISIKSEPISPPRDRMTPSGFQQQQQQQQQ
QQPPPPPQPQPQPPQPQPRQEMGRSPVDSLSSSSS
SYDGSDREDPRGDFHSPIVLGRPPNTEDRESPSVK
RMRMDAWVT
Isotype
IgG
Antibody clone number
1D2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -