Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501715 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Myocyte Enhancer Factor 2A (MEF2A) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MEF2A antibody: synthetic peptide directed towards the N terminal of human MEF2A
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELS
VLCDC EIALIIFNSS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Nuclear respiratory factor 1 controls myocyte enhancer factor 2A transcription to provide a mechanism for coordinate expression of respiratory chain subunits.
Ramachandran B, Yu G, Gulick T
The Journal of biological chemistry 2008 May 2;283(18):11935-46
The Journal of biological chemistry 2008 May 2;283(18):11935-46
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: MEF2A Sample Tissue: Human Fetal Heart Antibody Dilution: 1.0 μg/mL