H00025942-M01

SIN3A antibody from Abnova Corporation
DKFZP434K2235, KIAA0700

Antibody data

Product number
H00025942-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00025942-M01, RRID:AB_1580630
Product name
SIN3A monoclonal antibody (M01), clone 1B7
Provider product page
Abnova Corporation - H00025942-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SIN3A.
Antigen sequence
MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLA
PAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQS
SGSHGPAIAAVHSSHHHPTAVQPHGGQVV
Isotype
IgG
Antibody clone number
1B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -