Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA030278 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA030278, RRID:AB_10601976
- Product name
- Anti-NRP1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDIS
INNHISQEDCAKPADLDKKNPEIKIDETGSTPGYE
GEGE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Semaphorin 3A signaling through neuropilin-1 is an early trigger for distal axonopathy in the SOD1G93A mouse model of amyotrophic lateral sclerosis.
Venkova K, Christov A, Kamaluddin Z, Kobalka P, Siddiqui S, Hensley K
Journal of neuropathology and experimental neurology 2014 Jul;73(7):702-13
Journal of neuropathology and experimental neurology 2014 Jul;73(7):702-13
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows moderate granular positivity in glandular cells.
- Sample type
- HUMAN