Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008829-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008829-M05, RRID:AB_489861
- Product name
- NRP1 monoclonal antibody (M05), clone 1B3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NRP1.
- Antigen sequence
FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEW
LIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFD
GENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSD
YETHG- Isotype
- IgG
- Antibody clone number
- 1B3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Adjuvant effects of formalin-inactivated HSV through activation of dendritic cells and inactivation of myeloid-derived suppressor cells in cancer immunotherapy.
Ohkusu-Tsukada K, Ohta S, Kawakami Y, Toda M
International journal of cancer 2011 Jan 1;128(1):119-31
International journal of cancer 2011 Jan 1;128(1):119-31
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NRP1 monoclonal antibody (M05), clone 1B3 Western Blot analysis of NRP1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NRP1 expression in transfected 293T cell line by NRP1 monoclonal antibody (M05), clone 1B3.Lane 1: NRP1 transfected lysate(68.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NRP1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of NRP1 transfected lysate using anti-NRP1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NRP1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol