HPA000395

MORC4 antibody from Atlas Antibodies
FLJ11565, ZCW4, ZCWCC2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000395
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000395, RRID:AB_1079405
Product name
Anti-MORC4
Provider product page
Atlas Antibodies - HPA000395
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PRLVAEESNRGSTTINKEEVNKGPFVAVVGVAKGV
RDSGAPIQLIPFNREELAERRKAVESWNPVPYSVA
SAAIPAAAIGEKARGYEESEGHNTPKLKNQRELEE
LKRTTEKLERVLAERNLFQQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -