Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501732 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Nuclear Factor of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 1 (NFATC1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NFATC1 antibody: synthetic peptide directed towards the middle region of human NFATC1
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
STLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLG
LPQPA GEAPAVQDVP- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references ZNF652, a novel zinc finger protein, interacts with the putative breast tumor suppressor CBFA2T3 to repress transcription.
Kumar R, Manning J, Spendlove HE, Kremmidiotis G, McKirdy R, Lee J, Millband DN, Cheney KM, Stampfer MR, Dwivedi PP, Morris HA, Callen DF
Molecular cancer research : MCR 2006 Sep;4(9):655-65
Molecular cancer research : MCR 2006 Sep;4(9):655-65
No comments: Submit comment
No validations: Submit validation data