HPA027270

MAP3K14 antibody from Sigma-Aldrich
FTDCR1B, HS, HSNIK, NIK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027270
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027270, RRID:AB_10600884
Product name
Anti-MAP3K14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027270
Antibody type
Polyclonal
Antigen
mitogen-activated protein kinase kinase kinase 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EKNPSKASQSSRDTLSSGVHSWSSQAEARSSSWNM
VLARGRPTDTPSYFNGVKVQIQSLNGEHLHIREFH
RVKVGDIATGISSQIPAAAFSLVTKDGQP
Storage
-20C
Provider Type Product Number
- No reagents -