Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008850-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008850-M02, RRID:AB_714811
- Product name
- PCAF monoclonal antibody (M02), clone 1H2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PCAF.
- Antigen sequence
LEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINP
PPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLE
ANPGEKRKMTDSHVLEEAKKPRVMGDIPME- Isotype
- IgG
- Antibody clone number
- 1H2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PCAF monoclonal antibody (M02), clone 1H2. Western Blot analysis of PCAF expression in human uterus myoma.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PCAF monoclonal antibody (M02), clone 1H2 Western Blot analysis of PCAF expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PCAF monoclonal antibody (M02), clone 1H2. Western Blot analysis of PCAF expression in LNCaP ( Cat # L004V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PCAF expression in transfected 293T cell line by PCAF monoclonal antibody (M02), clone 1H2.Lane 1: PCAF transfected lysate(93 KDa).Lane 2: Non-transfected lysate.