H00008850-M12

KAT2B antibody from Abnova Corporation
GCN5, GCN5L, P/CAF, PCAF
No application information provided.

Antibody data

Product number
H00008850-M12
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008850-M12, RRID:AB_1136981
Product name
PCAF monoclonal antibody (M12), clone 1C9
Provider product page
Abnova Corporation - H00008850-M12
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PCAF.
Antigen sequence
QDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSS
SLEQPNAGSSSPACKASSGLE
Isotype
IgG
Antibody clone number
1C9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -