HPA021851

PKC2

Eligible for validation within the Antibodypedia Validation Initiative

SELECT THIS
ANTIBODY

PERFORM KNOCKDOWN
OR KNOCKOUT

SUBMIT POSITIVE
RESULTS

GET
REWARDED

Antibody data

Submit

Validation data

Product number: HPA021851
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA021851, RRID:AB_1855433
Product name: Anti-PRKCZ
Provider product page: Atlas Antibodies - HPA021851
Antibody type: Polyclonal
Reactivity: Human, Mouse
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: FNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRC HGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSE ETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIK ISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQI
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Provider	Type	Product Number
- No reagents -

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human retina shows strong cytoplasmic and membranous positivity in photoreceptor cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human retina shows strong cytoplasmic and membranous positivity in photoreceptor cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows moderate cytoplasmic/ membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human eye shows strong positivity in retina.
Sample type: MOUSE

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using Anti-PRKCZ antibody. Corresponding PRKCZ RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA021851 antibody. Corresponding PRKCZ RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.