Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310404 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Protein Kinase C, zeta (PRKCZ) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PRKCZ antibody: synthetic peptide directed towards the N terminal of human PRKCZ
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Rabbit
- Host
- Rabbit
- Antigen sequence
MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSS
RKHDS IKDDSEDLKP- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Activation of protein kinase C zeta by peroxynitrite regulates LKB1-dependent AMP-activated protein kinase in cultured endothelial cells.
Xie Z, Dong Y, Zhang M, Cui MZ, Cohen RA, Riek U, Neumann D, Schlattner U, Zou MH
The Journal of biological chemistry 2006 Mar 10;281(10):6366-75
The Journal of biological chemistry 2006 Mar 10;281(10):6366-75
No comments: Submit comment
No validations: Submit validation data