HPA021851

PRKCZ antibody from Sigma-Aldrich
PKC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021851
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021851, RRID:AB_1855433
Product name
Anti-PRKCZ antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021851
Antibody type
Polyclonal
Antigen
Protein kinase C zeta type recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRC
HGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSE
ETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIK
ISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQI
Storage
-20C
Provider Type Product Number
- No reagents -