HPA015515

MAPKAPK5 antibody from Sigma-Aldrich
PRAK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015515
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015515, RRID:AB_1853569
Product name
Anti-MAPKAPK5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015515
Antibody type
Polyclonal
Antigen
MAP kinase-activated protein kinase 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAED
SNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQ
EAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKL
AEIVKQVIEEQTTSH
Storage
-20C
Provider Type Product Number
- No reagents -