Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182410 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Jumonji Domain Containing 6 (JMJD6) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PTDSR antibody: synthetic peptide directed towards the middle region of human PTDSR
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
PRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTW
PPEFK PLEILQKPGE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Thyroid hormone induces rapid activation of Akt/protein kinase B-mammalian target of rapamycin-p70S6K cascade through phosphatidylinositol 3-kinase in human fibroblasts.
Phosphatidylserine receptor cooperates with high-density lipoprotein receptor in recognition of apoptotic cells by thymic nurse cells.
Cao X, Kambe F, Moeller LC, Refetoff S, Seo H
Molecular endocrinology (Baltimore, Md.) 2005 Jan;19(1):102-12
Molecular endocrinology (Baltimore, Md.) 2005 Jan;19(1):102-12
Phosphatidylserine receptor cooperates with high-density lipoprotein receptor in recognition of apoptotic cells by thymic nurse cells.
Cao WM, Murao K, Imachi H, Hiramine C, Abe H, Yu X, Dobashi H, Wong NC, Takahara J, Ishida T
Journal of molecular endocrinology 2004 Apr;32(2):497-505
Journal of molecular endocrinology 2004 Apr;32(2):497-505
No comments: Submit comment
No validations: Submit validation data