HPA024235

RABEP1 antibody from Atlas Antibodies
neurocrescin, RAB5EP, rabaptin-5, RABPT5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024235
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024235, RRID:AB_1856020
Product name
Anti-RABEP1
Provider product page
Atlas Antibodies - HPA024235
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ERQQHNQLKHTWQKANDQFLESQRLLMRDMQRMEI
VLTSEQLRQVEELKKKDQEDDEQQRLNKRKDHKKA
DVEEEIKIPVVCALTQEESSAQLSNEEEHLDSTRG
SVHSLDAGLLLPSGD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -