HPA024235

RABEP1 antibody from Sigma-Aldrich
neurocrescin, RAB5EP, rabaptin-5, RABPT5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024235
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024235, RRID:AB_1856020
Product name
Anti-RABEP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024235
Antibody type
Polyclonal
Antigen
Rab GTPase-binding effector protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ERQQHNQLKHTWQKANDQFLESQRLLMRDMQRMEI
VLTSEQLRQVEELKKKDQEDDEQQRLNKRKDHKKA
DVEEEIKIPVVCALTQEESSAQLSNEEEHLDSTRG
SVHSLDAGLLLPSGD
Storage
-20C
Provider Type Product Number
- No reagents -