Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91365 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91365, RRID:AB_2716653
- Product name
- Anti-RELN
- Antibody type
- Monoclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
TFCEPYGPRELITTGLNTTTASVLQFSIGSGSCRF
SYSDPSIIVLYAKNNSADWIQLEKIRAPSNVSTII
HILYLPEDAKGENVQFQWKQENLRVGEVYE- Epitope
- Binds to an epitope located within the peptide sequence SADWIQLEKIRAPSN as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL5324
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of mouse cerebral cortex shows positivity in the neuropil of layer 1, as well as cytoplasmic positivity in a subset of neurons in various layers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of mouse cerebral cortex shows immunoreactivity in the neuropil of layer 1, as well as cytoplasmic positivity in a subset of neurons in various layers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of mouse embryo E11 shows strong positivity in cells in the outer layer of developing cortical plate.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat cerebral cortex shows immunoreactivity in the neuropil of layer 1, as well as cytoplasmic positivity in a subset of neurons in various layers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat cerebral cortex shows immunoreactivity in the neuropil of layer 1, as well as cytoplasmic positivity in a subset of neurons in various layers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in a subset of neurons in layer 1.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected (negative control).