Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005984-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005984-M01, RRID:AB_464014
- Product name
- RFC4 monoclonal antibody (M01), clone 1C12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RFC4.
- Antigen sequence
GKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDK
LEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQ
KSIITEKLAEVDKCLADGADEHLQLISLCATVMQQ
LSQNC- Isotype
- IgG
- Antibody clone number
- 1C12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RFC4 monoclonal antibody (M01), clone 1C12 Western Blot analysis of RFC4 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RFC4 expression in transfected 293T cell line by RFC4 monoclonal antibody (M01), clone 1C12.Lane 1: RFC4 transfected lysate(39.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RFC4 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RFC4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol