Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000396-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000396-M02, RRID:AB_490099
- Product name
- ARHGDIA monoclonal antibody (M02), clone 1G5-2F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ARHGDIA.
- Antigen sequence
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSI
QEIQELDKDDESLRKYKEALLGRVAVSADPNVPNV
VVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLK
EGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKID
KTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSY
SIKSRFTDDDKTDHLSWEWNLTIKKDWKD- Isotype
- IgG
- Antibody clone number
- 1G5-2F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Comparative proteomic analysis on human L-02 liver cells treated with varying concentrations of trichloroethylene.
Liu J, Huang H, Xing X, Xi R, Zhuang Z, Yuan J, Yang F, Zhao J
Toxicology and industrial health 2007 Mar;23(2):91-101
Toxicology and industrial health 2007 Mar;23(2):91-101
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ARHGDIA monoclonal antibody (M02), clone 1G5-2F3. Western Blot analysis of ARHGDIA expression in human ovarian cancer.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ARHGDIA is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol