Antibody data

Product number
H00000396-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000396-M02, RRID:AB_490099
Product name
ARHGDIA monoclonal antibody (M02), clone 1G5-2F3
Provider product page
Abnova Corporation - H00000396-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant ARHGDIA.
Antigen sequence
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSI
QEIQELDKDDESLRKYKEALLGRVAVSADPNVPNV
VVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLK
EGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKID
KTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSY
SIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Isotype
IgG
Antibody clone number
1G5-2F3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -