HPA021407

ARHGDIA antibody from Sigma-Aldrich
GDIA1, RHOGDI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021407
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021407, RRID:AB_1856267
Product name
Anti-ARHGDIA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021407
Antibody type
Polyclonal
Antigen
Rho GDP-dissociation inhibitor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSI
QEIQELDKDDESLRKYKEALLGRVAVSAD
Storage
-20C
Provider Type Product Number
- No reagents -