H00006256-M34J

RXRA antibody from Abnova Corporation
NR2B1
No application information provided.

Antibody data

Product number
H00006256-M34J
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006256-M34J, RRID:AB_1136881
Product name
RXRA monoclonal antibody (M34J), clone 3F5
Provider product page
Abnova Corporation - H00006256-M34J
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant RXRA.
Antigen sequence
SMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGM
GPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQL
Isotype
IgG
Antibody clone number
3F5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -