Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005868-M09A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005868-M09A, RRID:AB_1016888
- Product name
- RAB5A monoclonal antibody (M09A), clone 5D1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAB5A.
- Antigen sequence
KELQRQASPNIVIALSGNKADLANKRAVDFQEAQS
YADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNE
PQNPGANSARGRGVDLTEPTQPTRNQCCSN- Isotype
- IgM
- Antibody clone number
- 5D1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Deregulation of Rab5 and Rab4 proteins in p85R274A-expressing cells alters PDGFR trafficking.
Chamberlain MD, Oberg JC, Furber LA, Poland SF, Hawrysh AD, Knafelc SM, McBride HM, Anderson DH
Cellular signalling 2010 Oct;22(10):1562-75
Cellular signalling 2010 Oct;22(10):1562-75
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RAB5A monoclonal antibody (M09A), clone 5D1 Western Blot analysis of RAB5A expression in K-562 ( Cat # L009V1 ).