WH0008557M1

TCAP antibody from MilliporeSigma / Merck KGaA
CMD1N, LGMD2G, T-cap, TELE, telethonin
ELISA
Recommended by provider

Antibody data

Product number
WH0008557M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0008557M1, RRID:AB_1843912
Product name
Monoclonal Anti-TCAP antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0008557M1
Antibody type
Monoclonal
Antigen
TCAP (AAH12628, a.a. 1-168) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MATSELSCEVSEENCERREAFWAEWKDLTLSTRPE
EGCSLHEEDTQRHETYHQQGQCQVLVQRSPWLMMR
MGILGRGLQEYQLPYQRVLPLPIFTPAKMGATKEE
REDTPIQLQELLALETALGGQCVDRQEVAEITKQL
PPVVPVSKPGALRRSLSRSMSQEAQRG* (witho
ut GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -