HPA026477

TCAP antibody from Atlas Antibodies
CMD1N, LGMD2G, T-cap, TELE, telethonin
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026477
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026477, RRID:AB_1857888
Product name
Anti-TCAP
Provider product page
Atlas Antibodies - HPA026477
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CEVSEENCERREAFWAEWKDLTLSTRPEEGCSLHE
EDTQRHETYHQQGQCQVLVQRSPWLMMRMGILGRG
LPEYQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -