H00008557-M03

TCAP antibody from Abnova Corporation
CMD1N, LGMD2G, T-cap, TELE, telethonin

Antibody data

Product number
H00008557-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008557-M03, RRID:AB_1205061
Product name
TCAP monoclonal antibody (M03), clone 1H3
Provider product page
Abnova Corporation - H00008557-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant TCAP.
Antigen sequence
MATSELSCEVSEENCERREAFWAEWKDLTLSTRPE
EGCSLHEEDTQRHETYHQQGQCQVLVQRSPWLMMR
MGIHGRGLQEYQLPYQRVLPLPIFTPAKMGATKEE
REDTPIQLQELLALETALGGQCVDRQEVAEITKQL
PPVVPVSKPGALRRSLSRSMSQEAQRG
Isotype
IgG
Antibody clone number
1H3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -