H00008557-M13A

TCAP antibody from Abnova Corporation
CMD1N, LGMD2G, T-cap, TELE, telethonin
No application information provided.

Antibody data

Product number
H00008557-M13A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008557-M13A, RRID:AB_1581288
Product name
TCAP monoclonal antibody (M13A), clone 1A3
Provider product page
Abnova Corporation - H00008557-M13A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TCAP.
Antigen sequence
MATSELSCEVSEENCERREAFWAEWKDLTLSTRPE
EGCSLHEEDTQRHETYHQQGQCQVLVQRSPWLMMR
MGILGRGLQEYQLPYQRVLPLPIFTPAKMG
Isotype
IgM
Antibody clone number
1A3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -