AV48227

TCAP antibody from MilliporeSigma / Merck KGaA
CMD1N, LGMD2G, T-cap, TELE, telethonin
No application information provided.

Antibody data

Product number
AV48227
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV48227, RRID:AB_1857886
Product name
Anti-TCAP (AB1) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV48227
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human TCAP with an internal ID of S23001
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGCSLHEEDTQRHETYHQQGQCQVLVQRSPWLMMR
MGILGRGLQEYQLPY
Storage
-20C
Provider Type Product Number
- No reagents -